PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010924066.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 392aa    MW: 43082.8 Da    PI: 10.0028
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010924066.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1738.7e-54211481128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l++
  XP_010924066.1  21 LPPGFRFHPTDEELVVHYLKKKAASAPLPV-TIIAEVDLYKFDPWELPGKANFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTS 114
                     79****************************.89***************999999**************************************998 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + ++vg+kk Lvfy g+ pkg kt+W+mheyrl
  XP_010924066.1 115 rGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 148
                     57788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-6415184IPR003441NAC domain
PROSITE profilePS5100562.23121184IPR003441NAC domain
PfamPF023653.9E-2822148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MESTDSSSGS RQQQQQQQPQ LPPGFRFHPT DEELVVHYLK KKAASAPLPV TIIAEVDLYK  60
FDPWELPGKA NFGEQEWYFF SPRDRKYPNG ARPNRAATSG YWKATGTDKP ILTSRGAQKV  120
GVKKALVFYG GKPPKGIKTN WIMHEYRLAD SSPGSSSRPP GCDAGSRRSS LRLDDWVLCR  180
IYKKNSNNNN NAQLMDRNRE DSMDDRMAPP AINTQPNPRP HHQRAPNNYT ALLDSDETFF  240
ERLLTTEDGL PTNPTSQLAG ASRPKMDLST IPTNNSTRAP KRALTSPYWS DAGMATPPPP  300
KRLQVCNNGS SPSKCTTTNN SNTRSGSNSS AANNSSSSNI NSNHGGRTIA ALLNQFPQGA  360
VYQHQTILGS LGDGSAIFQQ PYQLSGANWS SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-7561872168NO APICAL MERISTEM PROTEIN
1ut4_B4e-7561872168NO APICAL MERISTEM PROTEIN
1ut7_A4e-7561872168NO APICAL MERISTEM PROTEIN
1ut7_B4e-7561872168NO APICAL MERISTEM PROTEIN
4dul_A4e-7561872168NAC domain-containing protein 19
4dul_B4e-7561872168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010924066.10.0PREDICTED: NAC transcription factor 25-like
SwissprotA0SPJ91e-113NAM2_HORVD; NAC transcription factor NAM-2
TrEMBLA0A061F8181e-141A0A061F818_THECC; NAC domain protein, IPR003441
TrEMBLA0A151RBC41e-141A0A151RBC4_CAJCA; NAC domain-containing protein 18
STRINGGSMUA_Achr1P08860_0011e-141(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75723649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.16e-95NAC domain containing protein 2